Pay in 4 interest-free payments of $7.34 Learn more
Ships within 48 hours · Estimated delivery Nov 2 - Nov 7
To enroll in the program its $100 plus initial dosing vial (see vial prices above) which includes medical history review, dosing regimen, first vial/supplies for injections, initial instruction session and ongoing nursing support
1998 Oct;46(5):194-6
Easy to do, and I felt a lot more energetic
Additionally, older adults often experience decreased absorption capabilities due to changes in stomach acidity and digestive health
Adequate and well-controlled studies have not been done in pregnant women
Product Specifications Test Results Sample: Tesa, Ipamorelin, CJC 1295 6/3/3mg Certificate of Analysis Certificate of Analysis (Endotoxin) Third-party tested for ~99% purity Tesa Properties Source: PubChem Form: Lyophilized powder Unit size: 6mg/vial Unit quantity: 1 vial Molecular formula: C 223 H 370 N 72 O 69 S Molecular weight: 5196 g/mol Synonym: Tesamorelin acetate Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL CAS number: 901758-09-6 Ipamorelin Properties Source: PubChem Form: Lyophilized powder Unit size: 3mg/vial Unit quantity: 1 vial Molecular formula: C 38 H 49 N 9 O 5 Molecular weight: 711.9 g/mol Sequence: Aib-His-D-2-Nal-D-Phe-Lys CAS number: 170851-70-4 CJC-1295 Properties Source: PubChem Form: Lyophilized powder Unit size: 3mg/vial Unit quantity: 1 vial Molecular formula: C 152 H 252 N 44 O 42 Molecular weight: 3367.9 g/mol Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg CAS number: 863288-34-0 Frequently Asked Questions Related Products 3 of 45 products KPV (10mg) PNC-27 (10mg) How It Works Precision Synthesis Synthesized in dedicated, state of-the-art facilities
US$ 22.45
US$ 20.80
US$ 21.80
US$ 26.67
US$ 21.88